PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa05g016030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family GRAS
Protein Properties Length: 483aa    MW: 52983.5 Da    PI: 6.3652
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa05g016030.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS582e-18357438185
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfs 85 
                     l++lL++cA+av+++d ++a +lL++++++++p gd +qRla++f+++L+arla+++s++yk + +++ s    + +l+a++lf 
  Csa05g016030.1 357 LRSLLIHCAQAVAADDRRCAGQLLKQIRQHSTPFGDGNQRLAHCFANGLEARLAGTGSQIYKGIVSKPRS---AAAVLKAHQLFL 438
                     689*************************************************************999998...777788888775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098512.983331482IPR005202Transcription factor GRAS
PfamPF035147.0E-16357438IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 483 aa     Download sequence    Send to blast
MVTEPGLTGM SPSINRNRLP GLPDQSTSLL PNHTQFTPVS LYDGFNYNLS SSDHCNTVVA  60
APSEFIREIV EVEEEDPADD FDFSDAVLGY ISQMLNEEDM DDKVCMLQES LDLEAAERSL  120
YEAIGKKYPP SPERNLVVAS FAERNGENLD RVVPGNYTGG DCIGFGNGGI KPLSGGGFTL  180
DFRNPQSRCS SVLSVPQSNG FGMDQSSKKS LYADSSGESH QSVWLFRDGI EEANRLLPEQ  240
NELIVNFREE SCMSRGRKNS SRDEICVEEE ERSSKLPAVF GEDILRSDVV DKILVHVPGE  300
ESMKEFDALR EVLKKGVEKK KASVAQGGKR RARGRGRGRG GGRGGGGQNG KKEVVDLRSL  360
LIHCAQAVAA DDRRCAGQLL KQIRQHSTPF GDGNQRLAHC FANGLEARLA GTGSQIYKGI  420
VSKPRSAAAV LKAHQLFLAS LHKVNTFYHK DFVIDQDNRW LLQGWKGRTV MALSVWKPES  480
KA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1334343RGRGRGGGRG
2340346GGRGGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0046840.0AC004684.3 Arabidopsis thaliana chromosome 2 clone F13M22 map ve018, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010512995.10.0PREDICTED: scarecrow-like protein 9, partial
SwissprotO809330.0SCL9_ARATH; Scarecrow-like protein 9
TrEMBLR0HVC00.0R0HVC0_9BRAS; Uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_40018480.0(Arabidopsis lyrata)
STRINGfgenesh1_pg.C_scaffold_40018510.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35827189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.10.0GRAS family protein